PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn037021
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family LBD
Protein Properties Length: 387aa    MW: 42436 Da    PI: 9.7736
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn037021genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260134.34.5e-422143131100
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 +CaaCk+lrr+Ca++C+++pyf  ++p+kfa vhk+FGasnv+k+l ++pe++r da++slvyeA++r+rdPvyG++g i++lqqq+++l+ael+l+++
  Achn037021 214 PCAACKLLRRRCAQECPFSPYFSPHEPQKFATVHKVFGASNVSKMLMEVPESQRADAANSLVYEANVRLRDPVYGCMGAISALQQQVQSLQAELNLVRS 312
                 7***********************************************************************************************998 PP

      DUF260 100 e 100
                 e
  Achn037021 313 E 313
                 7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.803213314IPR004883Lateral organ boundaries, LOB
PfamPF031955.6E-42214311IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 387 aa     Download sequence    Send to blast
MLQTKHDEKL FSRFLSKENS KAEPSFGVLY YGGSSGTIPF MWESQPGTPK HPLSQTSLPT  60
LTPPPSYQST TTPKTKPTQK SSSRTKFLST LFPRFPSKKI NYVAPSFSSS FASSSSSFSS  120
SSTPMNAYVH RRGCLSRSRS SVPFGFDDDD EMATKSPTST LCFGGRLGFF KEFRGSRERF  180
DEIGKKIKRD SDTSIQMGRR YMVGPPGTLN TITPCAACKL LRRRCAQECP FSPYFSPHEP  240
QKFATVHKVF GASNVSKMLM EVPESQRADA ANSLVYEANV RLRDPVYGCM GAISALQQQV  300
QSLQAELNLV RSEILKYKYR DSDIIPSSHI ALFSSGVVSI ASPPPAPPPP PPPLPPASSS  360
SSLYTPLSTD TDYSTISNDQ NVPYFG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002279029.11e-112PREDICTED: LOB domain-containing protein 15
SwissprotQ8L5T52e-81LBD15_ARATH; LOB domain-containing protein 15
TrEMBLD7T4G01e-112D7T4G0_VITVI; Putative uncharacterized protein
STRINGVIT_13s0067g02380.t011e-111(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.11e-79LOB domain-containing protein 15